"action" : "pulsate" "actions" : [ "context" : "envParam:feedbackData", "event" : "unapproveMessage", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; }, }, "disableLabelLinks" : "false", { ] "event" : "AcceptSolutionAction", "action" : "rerender" }, { "disableLinks" : "false", "event" : "unapproveMessage", "context" : "", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "}); ] "context" : "envParam:quiltName", We have Europe’s largest fixed NGN footprint, Vodafone Business has SD-WAN coverage extending to 182 markets and we own Africa's leading mobile payment platform, M-Pesa. { { "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); "actions" : [ "showCountOnly" : "false", ] Es fallen die üblichen Verbindungskosten an, die je nach Tarif unterschiedlich sind. "selector" : "#messageview_0", "context" : "envParam:quiltName,message", "quiltName" : "ForumMessage", { ] }, Auf eine Antwort warten Sie in vielen Fällen jedoch bis zum nächsten Tag. ], watching = false; { }, { "action" : "pulsate" { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" }, "action" : "pulsate" ] "context" : "", "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); }, "context" : "", Check out our amazing range of smart devices. }, { "action" : "rerender" }, Execute whatever should happen when entering the right sequence $(event.data.selector).addClass('cssmenu-open') }); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "action" : "rerender" "context" : "", "event" : "ProductAnswerComment", ] }, ;(function($) { { ] "action" : "rerender" // just for convenience, you need a login anyways... var key = e.keyCode; "action" : "rerender" "useSubjectIcons" : "true", "selector" : "#messageview", "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "MessagesWidgetCommentForm", }, })(LITHIUM.jQuery); "context" : "envParam:quiltName,expandedQuiltName", "event" : "RevokeSolutionAction", "event" : "RevokeSolutionAction", }; "event" : "addMessageUserEmailSubscription", }); return; "actions" : [ { Zum Kontaktformular. }, ] ;(function($) { "actions" : [ { "selector" : "#messageview_1", } ] { "action" : "rerender" "action" : "rerender" Nach dem Anruf erhalten Sie direkt eine Nachricht vom Kundenservice bei WhatsApp. "action" : "rerender" ], Soy TOBi, el asistente virtual de Vodafone.Si ya eres cliente, entra en Mi Vodafone, donde te espero para ayudarte en todo lo que necesites. }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/7001/thread-id/92728","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ARYqIYx_q1QEP_FyDGMPrvShU991hfHhZ8-qco1VZOw. "action" : "rerender" { "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }); $(this).toggleClass("view-btn-open view-btn-close"); } "context" : "envParam:quiltName", "action" : "rerender" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1990985}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1990997}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1990997}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1991620}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507418}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509902}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514393}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513951}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512714}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515541}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515442}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515356}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515267}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515087}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2515024}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514976}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514837}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514665}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514494}}]); }); Folgendermaßen könnt ihr euch per E-Mail beschweren: Klickt auf folgenden Link, um zum Vodafone-Kontaktformular zu gelangen. { "context" : "envParam:feedbackData", // Oops, not the right sequence, lets restart from the top. "initiatorBinding" : true, "event" : "markAsSpamWithoutRedirect", ] } return; Befizetem . "actions" : [ { } }, "parameters" : { { } { "action" : "rerender" } "action" : "rerender" LITHIUM.AjaxSupport.useTickets = false; LITHIUM.AjaxSupport.useTickets = false; "actions" : [ "actions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "ProductMessageEdit", "event" : "removeMessageUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "action" : "rerender" { Bei komplexeren Probleme wird Ihre Nachricht an einen Mitarbeiter weitergeleitet, der sich nach wenigen Minuten bis Stunden bei WhatsApp zurückmeldet. { } } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", { "context" : "envParam:quiltName,product,contextId,contextUrl", }, .attr('aria-selected','true'); "initiatorDataMatcher" : "data-lia-kudos-id" }, "linkDisabled" : "false" }, var clickHandler = function(event) { "action" : "rerender" } //$('#lia-body').removeClass('lia-window-scroll'); } "context" : "", "entity" : "1990997", { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'lt9esI7ZAygcJLmKtbo5FPo-TTY0J0KIoq-lz68a2-o. "event" : "ProductAnswerComment", "event" : "MessagesWidgetMessageEdit", ] }, ], Bist du sicher, dass du fortfahren möchtest? }, "action" : "rerender" "actions" : [ "event" : "kudoEntity", "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, { { }, "actions" : [ { "context" : "", } "showCountOnly" : "false", "quiltName" : "ForumMessage", element.siblings('li').removeClass('active'); "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'V5VkrpyFyNUQwGHnoojmL-B1xT-GA8VeZ2RXFqClNig. "actions" : [ "context" : "lia-deleted-state", We're still putting our customers at the heart of what we do, forever challenging and pushing the boundaries of digital to give them new, ingenious and hassle-free ways to connect with their worlds. LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'V5VkrpyFyNUQwGHnoojmL-B1xT-GA8VeZ2RXFqClNig. "selector" : "#kudosButtonV2_2", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }); "initiatorBinding" : true, }, ] }, ], }, { "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'y7mKmE5HKd-ZR9e7nalX3DtSqfet37qZLuEzLRIesOs. "actions" : [ "disallowZeroCount" : "false", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "context" : "envParam:feedbackData", function createStorage(option){ "action" : "rerender" { "context" : "envParam:quiltName", { } { "action" : "addClassName" .attr('aria-hidden','true') "action" : "rerender" } }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "message" : "1990997", }, "actions" : [ count = 0; "initiatorBinding" : true, "displaySubject" : "true", ] "action" : "rerender" { ;(function($){ "context" : "", }, element.addClass('active'); } } }, "componentId" : "kudos.widget.button", "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", }, ], "event" : "deleteMessage", Per Fax erreichen Sie Vodafone unter folgender Nummer: 0210-2986575. } $(document).keydown(function(e) { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", .attr('aria-selected','false'); } Ohne Direktlink musst du über Kontakt gehen und mittels Stichwortsuche gelangst du dann zum Kontaktformular. { "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } $('section.header-announcement').slideUp(); "context" : "envParam:entity", { "dialogKey" : "dialogKey" "action" : "rerender" "event" : "MessagesWidgetEditAction", LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); All underpinned by our leading mobile networks with deep spectrum positions. { }, }, { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'FZrC3q3arTw3hrWp7UZhu0bMgX0Tsaq7k0fVdERz6PE. "action" : "addClassName" ] "selector" : "#kudosButtonV2_1", "event" : "addMessageUserEmailSubscription", }, }, "action" : "rerender" "truncateBodyRetainsHtml" : "false", "action" : "rerender" "actions" : [ "actions" : [ }, VPN mit IPSec Client von Lancome funktioniert nich... Emails und Ordner gelöscht, Versand nicht möglich. }); } "event" : "removeMessageUserEmailSubscription", "actions" : [ "actions" : [ "action" : "rerender" } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/92728","ajaxErrorEventName":"LITHIUM:ajaxError","token":"n4kW-XiAh-j25UFMxMWxm3RpJrJBl3s7Okrg9ghJl8k. { "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetAnswerForm", }, { { "actions" : [ { { $(document).keydown(function(e) { "eventActions" : [ ] Please close this window and try again. "event" : "QuickReply", "action" : "rerender" }); { "context" : "envParam:selectedMessage", }); ] { LITHIUM.Dialog.options['-1185420644'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" Befizetem . "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", // Reset the conditions so that someone can do it all again. "context" : "envParam:feedbackData", { ] })(LITHIUM.jQuery); // Pull in global jQuery reference } } "actions" : [ Si no eres cliente Vodafone, puedes llamar al 1444 ¡Hola! LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { für mit oder grüner Unterstreichung gekennzeichnete. "actions" : [ "actions" : [ } }, "eventActions" : [ ] }, ] }, ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "kudosable" : "true", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/7001/thread-id/92728","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HLFfiREytnUC_b0qb_QITp0RSRiDIUIMFOe4DHflebM. }, ', 'ajax'); "action" : "rerender" }, } "actions" : [ { }, // --> Kann ich Vodafone per E-Mail kündigen? Dann hilft Dir die Kundenbetreuung für unsere Freemailer. ] "initiatorBinding" : true, "context" : "envParam:quiltName,message", CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "context" : "envParam:feedbackData", if ( watching ) { }, "action" : "rerender" "action" : "rerender" "action" : "pulsate" { "triggerEvent" : "LITHIUM:triggerDialogEvent", "context" : "", "action" : "rerender" count = 0; "context" : "", ] } LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "QuickReply", { "event" : "MessagesWidgetEditCommentForm", }, }, //} else { element.siblings('li').find('ul').slideUp(); } }, })(LITHIUM.jQuery); })(LITHIUM.jQuery); "event" : "removeThreadUserEmailSubscription", } LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ', 'ajax'); "actions" : [ }, "context" : "envParam:quiltName,expandedQuiltName", ] "truncateBody" : "true", } else { { "context" : "envParam:quiltName,message", } "context" : "envParam:selectedMessage", $('#node-menu li.has-sub>a').on('click', function(){ ] // Oops, not the right sequence, lets restart from the top. }, "floatedBlock" : "acceptedSolutions", { ] "includeRepliesModerationState" : "false", // console.log('watching: ' + key); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "event" : "unapproveMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" "truncateBody" : "true", "event" : "ProductMessageEdit", ] "action" : "rerender" }, ] "action" : "rerender" if ( neededkeys[count] == key ) { LITHIUM.AjaxSupport.ComponentEvents.set({ "forceSearchRequestParameterForBlurbBuilder" : "false", { ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "action" : "rerender" { { Schicke deine Vodafone Kündigung an folgende E-Mail-Adresse: kontakt@vodafone.com "context" : "lia-deleted-state", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ ], "context" : "envParam:quiltName", "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { "action" : "rerender" }, return; } "actions" : [ LITHIUM.Dialog({ Zum Kontaktformular: Update 27.06.2018: Über den Link lässt sich derzeit keine E-Mail an Vodafone schreiben. } "actions" : [ createStorage("true"); resetMenu(); "action" : "rerender" $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.Dialog.options['1642205346'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "initiatorDataMatcher" : "data-lia-kudos-id" $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); { { ] "actions" : [ } "useTruncatedSubject" : "true", "action" : "pulsate" } { } { notifCount = parseInt($(this).html()) + notifCount; "disableLinks" : "false", ] "context" : "envParam:quiltName", "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "context" : "", "event" : "kudoEntity", }, }, "action" : "pulsate" resetMenu(); "action" : "rerender" "event" : "MessagesWidgetEditAction", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { } { } "event" : "addMessageUserEmailSubscription", "action" : "rerender" "actions" : [ Vodafone says it will switch off auto-forwarding for Vodafone Mail - despite promising free forwarding for life. Vodafone says all its email customers will receive an email with the news of the closure, support around how to set up auto-forwarding and an introduction to Google gmail and Microsoft Outlook. ;(function($) { { "actions" : [ "parameters" : { { return; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); $(this).next().toggle(); } { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "addClassName" { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1990997,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "disableKudosForAnonUser" : "false", "kudosLinksDisabled" : "false", "action" : "rerender" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "envParam:entity", "kudosLinksDisabled" : "false", ], }, "initiatorBinding" : true, "disableLabelLinks" : "false", "action" : "pulsate" LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '7vAjFSfmpuWzNqheBLrMwbTPFW1Nc83StxqXENmiX-4. { }, "initiatorBinding" : true, "context" : "", "action" : "rerender" "actions" : [ var cookieDomain = 'forum.vodafone.de'; }, } To find out more you can view our policy here. } "action" : "rerender" Auch die Kontaktaufnahme per E-Mail ist bei Vodafone kinderleicht. "action" : "rerender" "accessibility" : false, "actions" : [ "componentId" : "kudos.widget.button", "event" : "AcceptSolutionAction", "event" : "ProductAnswer", { ;(function($) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); } }, "truncateBody" : "true", ] "event" : "expandMessage", } ] ctaHTML += "Lösung noch nicht gefunden? { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); ] ] var watching = false; "componentId" : "kudos.widget.button", { "parameters" : { { "actions" : [ "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. { { { ', 'ajax'); }, { } Bist du sicher, dass du fortfahren möchtest? { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); }, ] "linkDisabled" : "false" CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "entity" : "1990997", "useSimpleView" : "false", "event" : "MessagesWidgetEditAction", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1990997 .lia-rating-control-passive', '#form_0'); "event" : "MessagesWidgetEditAction", "actions" : [ Email alerts. For media enquiries about Vodafone Group financial or corporate matters, please contact us at [email protected].. We monitor our emails seven days a week, and one of the team will be back in contact with you as soon as possible – typically within an hour. "disallowZeroCount" : "false", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); ] // If watching, pay attention to key presses, looking for right sequence. lithstudio: [], { setCookie: function(cookieName, cookieValue) { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "action" : "rerender" } //resetMenu(); "linkDisabled" : "false" "actions" : [ "event" : "addMessageUserEmailSubscription", { "actions" : [ "}); "context" : "", { { ;(function($) { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "disableKudosForAnonUser" : "false", "actions" : [ { } }, "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1991620 .lia-rating-control-passive', '#form_2'); "context" : "envParam:quiltName,message", "disableLabelLinks" : "false", } "buttonDialogCloseAlt" : "Schließen", } })(LITHIUM.jQuery); } { Ein Unternehmen das in den letzten Jahren immer größer wurde. "event" : "RevokeSolutionAction", ] "action" : "rerender" "displayStyle" : "horizontal", { })(LITHIUM.jQuery); }, //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} $(document).ready(function(){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "action" : "rerender" "event" : "unapproveMessage", $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); expireDate.setDate(expireDate.getDate() + 365*10); // --> LITHIUM.Dialog.options['-1868328398'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};